PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 378aa    MW: 41716.5 Da    PI: 8.3764
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34631.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.2e-18108153147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ede+l+++v+q+G+ +W++Ia+ +  gR++k+c++rw++ 
       KHN34631.1 108 RGHWRPAEDERLKELVAQYGPQNWNLIAENLE-GRSGKSCRLRWFNQ 153
                      899*****************************.***********996 PP

2Myb_DNA-binding55.71.1e-17160203146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
       KHN34631.1 160 RRSFSEEEEERLITAHRMYGNK-WAMIARLFP-GRTDNAVKNHWHV 203
                      6789******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.96103154IPR017930Myb domain
SMARTSM007178.0E-15107156IPR001005SANT/Myb domain
PfamPF002491.2E-16108153IPR001005SANT/Myb domain
SuperFamilySSF466892.36E-28108201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-26109161IPR009057Homeodomain-like
CDDcd001677.15E-14111152No hitNo description
PROSITE profilePS5129426.867155209IPR017930Myb domain
SMARTSM007173.3E-15159207IPR001005SANT/Myb domain
PfamPF002491.4E-14160202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-20162207IPR009057Homeodomain-like
CDDcd001671.28E-7171202No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MSSSQHLNNV GEGSNRDMSF FPPSSLYVGS SQTPPLSMGH ENGVEGSKPE MGLQIFGSTV  60
FQPSECRGTK RASDEEGVEI ENRNLCLKLA DEAQAKSSAS GKIKLCARGH WRPAEDERLK  120
ELVAQYGPQN WNLIAENLEG RSGKSCRLRW FNQLDPRINR RSFSEEEEER LITAHRMYGN  180
KWAMIARLFP GRTDNAVKNH WHVIMARRQR EHSSSVYRRR KLVVNETLPK GLDLTLSNNA  240
GSESTISSTI DESASTCTNL SLTPSSAKVT PPFRRLFDHP GPSQNHQAFG SLIGQARGDV  300
SFNKFCGASW KGVAYKKADQ VGKLKGVDQS NFSDANSEVS VSESVATNRS NVSISEESET  360
VGDKINMPFI DFLGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-331082084104C-Myb DNA-Binding Domain
1msf_C2e-331082084104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311830.0KT031183.1 Glycine max clone HN_CCL_37 MYB/HD-like transcription factor (Glyma03g00980.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553355.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0B2RJ470.0A0A0B2RJ47_GLYSO; Transcription factor MYB44
TrEMBLI1N8F40.0I1N8F4_SOYBN; Uncharacterized protein
STRINGGLYMA19G29670.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.12e-66myb domain protein 117
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]